Huddleston Estate

online only auction | 21 day sale | sale is over
Location
Marble Falls, TX 78654
Dates

Sale Starts

Sat
Jun 10
12am
2023

Sale Ends

Fri
Jun 30
12pm
2023

Terms & Conditions

Waddle Auctioneers, LLC Terms and Conditions
1. PAYMENT INSTRUCTIONS:
a. You must be at least 18 years old and have a valid credit card on file with our company to register for and participate in our auctions.
b. The first time you save a new card to your account, there is a $1.00 soft charge and void to confirm there are funds available. This soft charge will automatically be voided in 5-7 business days, depending on your financial institution and merchant services provider. Waddle Auctioneers, LLC does not receive these funds in any way. You must reach out to your financial institution for resolution beyond the typical timeframe.
c. Your credit card on file with our company will NOT automatically be charged at the close of the auction. Your invoice will be emailed to you within 12 hours of the auction closing time if you are the highest bidder. ALL BUYERS ARE RESPONSIBLE FOR PAYING THEIR INVOICES WITHIN 48 HOURS or risk losing their items to the next highest bidder.
d. All invoices include a non-negotiable 10% buyers fee and an optional 3% credit card fee.
e. Buyers are responsible for requesting alternative forms of payment, such as cash, cashier's check, or wire transfer, IN WRITING, via text or email before paying their invoice. Refunds will not be issued because a buyer wants to avoid the credit card fee.
f. Buyers who have pre-arranged another form of payment such as cash, cashier’s check, or wire transfer for invoices of any amount must have EXACT CHANGE. No discounts or change will be available at the pick up location.
g. Cash payments must be made with exact change. No discounts for cash payments.
h. No personal or out-of-state checks will be accepted.
i. Wire transfers will have a $30 fee applied to the invoice total.
j. If your invoice is not paid within seven business days of the auction closing for any reason, our auction house reserves the right to ban you from future auctions. This will affect your ability to bid on any current or future auctions with Waddle Auctioneers, LLC.
k. You may be offered a company credit for overpayments or other credits.

2. PAYMENT INFORMATION:
a. Waddle Auctioneers, LLC accepts:
• Discover, MasterCard, Visa, American Express
• Cash (Must Be Exact Change)
• Cashier's Check
• Wire Transfers
b. The currency for all purchases is USD, U.S. dollars.
c. There is a 10% buyer’s premium on all winning bids.
d. Credit card transactions are subject to an additional 3% convenience fee.
e. Buyer agrees to not initiate a chargeback for their purchases under any circumstances. If you initiate a chargeback for any reason, the auction house reserves the right to ban you from future auctions.
f. Waddle Auctioneers, LLC DOES NOT offer transportation, storage, shipping, handling, or any additional specialized services unless requested and arranged under certain specialized circumstances. If you require special assistance, please contact us before the close of the auction to make arrangements.
g. Auctions with inventory located outside of Texas may be subject to additional sales tax as required by the corresponding municipality or state, and will be specified in the auction.

3. PREVIEW:
a. Previews are available by appointment only and are subject to the seller's and auctioneer's schedules.
b. Additional photographs, videos, or condition reports may or may not be available upon request. Please forward requests to Larry@LarryWaddle.com or Ry@RyZimm.com

4. PICK-UP:
a. 3 DAYS ONLY:
• Pick up is available by appointment only between 10 am - 5 pm on Saturday, July 1 through Monday, July 3.
• Ry will reach out to high bidders to schedule appointments as soon as the auction closes.
• Additional pick up appointments may be available by special request between Wednesday, July 5 through Saturday, July 8.
• Bring a photo ID and be prepared to present your email invoice receipt of purchase.
b. All inventory is located at the seller's personal property in Marble Falls, Texas. In the interest of protecting our client's privacy, the address will be made available to the high bidders at the close of the auction.
c. Loading, transportation, and any required disassembly of items is the sole responsibility of the buyer. We do not provide tools for disassembly or assist with moving heavy objects.
d. Please call Ry at 956-867-7759 in advance to schedule pick-ups beyond the initial three-day window when applicable for an auction. Not all auctions have flexibility on pick-up dates or have shipping services available.
e. We require written permission for all pick-ups on a buyer’s behalf. Email us at Ry@RyZimm.com or text us at 956-867-7759 to request a substitute pick-up person in your place.
f. Any inventory paid for but not collected by the close of the third pick-up day with no communication or contact from the buyer will be relisted in another auction or offered to the next highest bidder.

5. VEHICLE PURCHASES:
a. All transfer and registration fees are non-negotiable, calculated by the local state and municipality, and transfers are the sole responsibility of the buyer.
b. Waddle Auctioneers, LLC prefer that vehicle title transfers be made in the winning bidder’s name, or their company’s name for commercial vehicle title transfers.
c. Payment must be made within two business days following the auction and all necessary paperwork completed at that time.
d. Vehicle miles are accurate at the time of cataloging, they may change very slightly, not to exceed 25 miles beyond what is advertised.
e. Pick-up time must be scheduled to allow for paperwork and processing.
f. Some vintage or antique vehicles may require towing or other arrangements. Some vehicles may not have a title and will require a Bill of Sale or buyer will need to obtain a Bonded title. All information will be communicated to bidders before final payments are made. Please feel free to refer any questions to Larry@LarryWaddle.com or Ry@RyZimm.com

6. BIDDING ONLINE:
a. All bids placed are final. As a company policy, we do not retract bids as it messes with the integrity of the auction. If you default on payment or have your high bid removed for any reason, you will be liable for any difference in sale price between what your high bid was, and the final sale price of the lot.
b. The auction will close at a rate of one lot per minute. If a bid is placed within an item's closing minute, the lot will be automatically extended by one minute.
c. Bid increments are subject to change at any time at the auctioneer's discretion.
d. The auctioneer reserves the right to lift a reserve price at any time which guarantees a sale to the highest bidder at any price.
e. Being the high bidder on an item, with or without reserve, is a legally binding commitment to purchase the item for the amount of the high bid. This does not include Maximum Bids which exceed the amount of the current high bid.
f. Waddle Auctioneers, LLC is providing Internet auction bidding as a service to Bidder. Bidder acknowledges and understands that this service may or may not function correctly on the day of the auction. Under no circumstances shall Bidder have any kind of claim Waddle Auctioneers, LLC or anyone else if the Internet service fails to work correctly before or during the timed or live online auction. Waddle Auctioneers, LLC will not be responsible for any missed bids from any source. Internet bidders who desire to make certain their bids are acknowledged should use the website feature and leave their maximum bid 24 hours before the auction ends.
g. Waddle Auctioneers, LLC reserves the right to withdraw, re-sequence, or re-catalog items in this auction at any time, for any reason.

7. CONDITIONS OF SALE:
a. All property is sold “AS IS”, “WHERE IS” and ALL SALES ARE FINAL. Bidder agrees that everything is sold as-is and that they may not return any item they purchase. THERE ARE NO REFUNDS.
b. Items may have wear and tear, imperfections, or the effects of aging. Any condition statement given, as a courtesy to a client, is only an opinion and should not be treated as a statement of fact. All dimensions provided are approximate.
c. Buyers are always encouraged to inspect items in person prior to bidding to make their own determinations as to condition, age, size, authenticity, value and any other determining factor by appointment only. Not all inventory will be open for previews. Additional detailed condition reports such as photos, videos, or other, can likely be provided upon request with enough advance notice at least 48 hours prior to auction closing. Bidder shall be the sole judge of value and authenticity and may not make any contest regarding any determining factor. Bidders who participate from off-site and forego the opportunity to be present at the preview understand and acknowledge that this affects their ability to inspect an item as well as if they examined it in person.
d. Waddle Auctioneers, LLC may attempt to describe the merchandise in advertising, on the Internet, and at the auction but makes no representations. In no event shall Waddle Auctioneers, LLC be held responsible for having made or implied any warranty of merchantability or fitness for a particular purpose. Waddle Auctioneers, LLC shall endeavor to describe in detail each item and any pertinent information about it.
e. Waddle Auctioneers, LLC will not be responsible for any errors or omissions in the description of the merchandise unless it is a material misrepresentation of the item itself.
f. Any high/low estimates provided are a courtesy only, and not a guarantee of the sales price.

8. WARRANTIES OF OWNER/REPRESENTATIVE:
a. The owner/representative warrants that he/she is the owner or has the right to sell listed items and has merchantable title to the items of personal property offered for sale and hereby grants to the Auctioneer the right to convey a merchantable title to successful high Bidder after payment has been received in full. The Owner/representative guarantees clear title, except where otherwise noted. In the event the owner/representative is unable to clear the title, the owner/representative will be liable for any pre-sale expenses incurred by the Auctioneer, and/or a withdrawal fee.

9. GOVERNING LAW & VENUE:
a. This agreement is governed by and construed in compliance with the domestic laws of the State of Texas without giving effect to any choice-of-law or conflict-of-law provision or rule (whether of the State of Texas or of any other jurisdiction) that would cause the application of the laws of any jurisdiction except the State of Texas. All disputes related to this agreement shall be resolved in a court of law located in Burnet County, Texas.

10. ACCEPTANCE:
a. By bidding in our auction, the Bidder accepts and agrees that they have read and agreed to the Terms & Conditions of the auction in their entirety. Thank you for your understanding, accordance, and acceptance of these Terms & Conditions.
Waddleauctioneers.com, LLC Logo

Waddleauctioneers.com, LLC

Company Website

Description & Details

Bid Online NOW!

Bid.WaddleAuctioneers.com

This HUGE Online Estate Sale features

antique Cars from 1940's, 1950's, 1960's, 1970's, and 1980's

antique Tractors

vintage clothes, faux and real furs, and outfits from various decades

arts and crafts supplies

Glassware of various types

Vintage and Antique Books

All different types of tools, horse items, and more

Antique Furniture and jukeboxes

Antique and Vintage toys

children's books including board books to chapter books

vintage costume jewelry of all kinds and decades, including hat pins and brooches

riding mowers, golf karts, trailers, and car parts

1950's Country musicians promotional materials and photos

1800's and early 1900's silver and silver plated silverware and serving dishes

Compelling framed and unframed art pieces and prints

Vintage hats and purses

vintage and antique magazines and newspapers of significant events and more

Dale Earnhardt collector items

Sports cards and collectible cards

Antique and vintage quilts and hand crocheted/knitted blankets

Vintage sewing machine

vintage and antique sewing patterns, ribbons, trims

Mid century modern, Art deco and different styles of home décor

Vintage Christmas, Easter, and other seasonal decor

MUCH MORE! Over 600 lots of items to bid on!

rollsHuddlestonQRblackminkbikebellSale Picturechainsbooksbottlebridlescoalheaterantiquesewing69cutlassskullramchopsawcomicsautotestersSale PicturedinnersetbafftubcrockwashtaubcedartrunkfordflatbedSale PicturedoiliesSale PictureeighttracksfrenchieenamelwarechevyblazerfurngolfcarthandcrackphonehatSale PicturekidbookscraftironstoveSale PicturegoatheadjewelryfridgegentlemanniehoffcabinetmidcenturymermaidmilkSale PictureshipmusicbookspachinkomachinepocketknivespopSale PictureSale PicturepursepulliesSale Pictureradialoldtruckpinballsewingpattrolexpurse2,jpgsilvergobletoldcarSale PicturebobrossramsheadSale PicturesafesandblasterSale Pictureteacupssawsschoolbellsewingpattsingersewingslicer,jpgSale PicturetractrSale PictureSale Picturewillie

Thank you for using EstateSales.NET. You're the best!